Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chp Protein

This chp Protein spans the amino acid sequence from region 29-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CHIPS)

UniProt

Q2FWV5

Expression Region

29-149aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain NCTC 8325 / PS 47)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FTFEPFPTNEEIESNKKLLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hist3h2a 3'UTR Luciferase Stable Cell Line
TU109585 1.0 mL

Hist3h2a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MEM Amino Acid Solution, 50 x
PB180425 100 mL

MEM Amino Acid Solution, 50 x

Sign In for Pricing
View Details
PLA2G7, ID (PLA2G7, PAFAH, Platelet-activating factor acetylhydrolase, 1-alkyl-2-acetylglycerophosphocholine esterase, 2-acetyl-1-alkylglycerophosphocholine esterase, Group-VIIA phospholipase A2, LDL-associated phospholipase A2, PAF 2-acylhydrolase) (MaxLight 490) discontinued
040122-ML490 100 µL

PLA2G7, ID (PLA2G7, PAFAH, Platelet-activating factor acetylhydrolase, 1-alkyl-2-acetylglycerophosphocholine esterase, 2-acetyl-1-alkylglycerophosphocholine esterase, Group-VIIA phospholipase A2, LDL-associated phospholipase A2, PAF 2-acylhydrolase) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ART5 Recombinant Protein (Rat)
RP191087 100 µg

ART5 Recombinant Protein (Rat)

Sign In for Pricing
View Details
KLHDC1 Antibody
MBS9523999-01 0.04 mL

KLHDC1 Antibody

Sign In for Pricing
View Details
KLHDC1 Antibody
MBS9523999-02 0.1 mL

KLHDC1 Antibody

Sign In for Pricing
View Details