Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DhaA Protein

This dhaA Protein spans the amino acid sequence from region 1-304aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8U671

Expression Region

1-304aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58) )

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKEHRHMTEKSPHSAFGDGAKAYDVPAFGLQIHTVEHGSGAPIVFLHGNPTSSYLWRHIFRRLHGHGRLLAVDLIGYGQSSKPDIEYTLENQQRYVDAWFDALDLRNVTLVLQDYGAAFGLNWASRNPDRVRAVAFFEPVLRNIDSVDLSPEFVTRRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTPFPTPHSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFKPGFLLTDAILKWSQVTIRNLEIEAAGAGIHFVQEEQPETIARLLDAWLTRIAGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ISG15 Protein
ARP2683-01 10 µg

Recombinant Human ISG15 Protein

Sign In for Pricing
View Details
Recombinant Human ISG15 Protein
ARP2683-02 50 µg

Recombinant Human ISG15 Protein

Sign In for Pricing
View Details
Recombinant Human ISG15 Protein
ARP2683-03 100 µg

Recombinant Human ISG15 Protein

Sign In for Pricing
View Details
Recombinant Human ISG15 Protein
ARP2683-04 1 mg

Recombinant Human ISG15 Protein

Sign In for Pricing
View Details
NT-3 (Neurotrophin 3, Neurotrophin-3, NT3, NTF3, HDNF, MGC129711, Nerve Growth Factor 2, Nerve Growth Factor-2, NGF2, NGF-2, Neurotrophic Factor) (AP)
MBS6403918-01 0.1 mL

NT-3 (Neurotrophin 3, Neurotrophin-3, NT3, NTF3, HDNF, MGC129711, Nerve Growth Factor 2, Nerve Growth Factor-2, NGF2, NGF-2, Neurotrophic Factor) (AP)

Sign In for Pricing
View Details
NT-3 (Neurotrophin 3, Neurotrophin-3, NT3, NTF3, HDNF, MGC129711, Nerve Growth Factor 2, Nerve Growth Factor-2, NGF2, NGF-2, Neurotrophic Factor) (AP)
MBS6403918-02 5x 0.1 mL

NT-3 (Neurotrophin 3, Neurotrophin-3, NT3, NTF3, HDNF, MGC129711, Nerve Growth Factor 2, Nerve Growth Factor-2, NGF2, NGF-2, Neurotrophic Factor) (AP)

Sign In for Pricing
View Details