Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FabG Protein

This fabG Protein spans the amino acid sequence from region 1-244aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(3-ketoacyl-acyl carrier protein reductase) (Beta-Ketoacyl-acyl carrier protein reductase) (Beta-ketoacyl-ACP reductase)

UniProt

P0AEK2

Expression Region

1-244aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG2a Antibody (PE)
orb688666 100 µL

IgG2a Antibody (PE)

Sign In for Pricing
View Details
3-[ (Benzyloxy) methyl]cyclobutan-1-amine hydrochloride
XLD08196-01 50 mg

3-[ (Benzyloxy) methyl]cyclobutan-1-amine hydrochloride

Sign In for Pricing
View Details
3-[ (Benzyloxy) methyl]cyclobutan-1-amine hydrochloride
XLD08196-02 0.5 g

3-[ (Benzyloxy) methyl]cyclobutan-1-amine hydrochloride

Sign In for Pricing
View Details
Hsa-miR-6850-3p miRNA Antagomir
orb1913946-01 10 nmol

Hsa-miR-6850-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-6850-3p miRNA Antagomir
orb1913946-02 20 nmol

Hsa-miR-6850-3p miRNA Antagomir

Sign In for Pricing
View Details
Map3k14 Antibody
orb1268518 400 μl

Map3k14 Antibody

Sign In for Pricing
View Details