Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VP35 Protein

This VP35 Protein spans the amino acid sequence from region 1-329aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Marburg VP35) (mVP35)

UniProt

P35259

Expression Region

1-329aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Lake Victoria marburgvirus (strain Musoke-80) (MARV) (Marburg virus (strain Kenya/Musoke/1980) )

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MWDSSYMQQVSEGLMTGKVPIDQVFGANPLEKLYKRRKPKGTVGLQCSPCLMSKATSTDDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAKYDHLVISTGRTTAPAAAFDAYLNEHGVPPPQPAIFKDLGVAQQACSKGTMVKNATTDAADKMSKVLELSEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPSQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AGXT antibody
STJ110695 100 µl

Anti-AGXT antibody

Sign In for Pricing
View Details
Dog Interleukin 18 (IL18) ELISA Kit
orb2811903-01 48 Tests

Dog Interleukin 18 (IL18) ELISA Kit

Sign In for Pricing
View Details
Dog Interleukin 18 (IL18) ELISA Kit
orb2811903-02 96 Tests

Dog Interleukin 18 (IL18) ELISA Kit

Sign In for Pricing
View Details
Dog Interleukin 18 (IL18) ELISA Kit
orb2811903-03 5 x 96 T

Dog Interleukin 18 (IL18) ELISA Kit

Sign In for Pricing
View Details
LRSAM1, NT (LRSAM1, TAL, E3 ubiquitin-protein ligase LRSAM1, Leucine-rich repeat and sterile alpha motif-containing protein 1, Tsg101-associated ligase) (MaxLight 405) discontinued
037988-ML405 100 µL

LRSAM1, NT (LRSAM1, TAL, E3 ubiquitin-protein ligase LRSAM1, Leucine-rich repeat and sterile alpha motif-containing protein 1, Tsg101-associated ligase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Cavy Glucoprotein 130 ELISA Kit
MBS021411 Inquire

Cavy Glucoprotein 130 ELISA Kit

Sign In for Pricing
View Details