Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TusA Protein

This tusA Protein spans the amino acid sequence from region 1-79aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9I3F3

Expression Region

1-79aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTHSVDAILDATGLNCPEPVMMLHNKVRDLAPGGLLKVIATDPSTRRDIPKFCVFLGHELVEQQEEAGTYLYWIRKKAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clic4 Mouse Gene Knockout Kit (CRISPR)
KN503461 1 Kit

Clic4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P14ARF (4C6/4), CF568 conjugate, 0.1mg/mL
BNC682088-500 1x 500 µL

P14ARF (4C6/4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Propionic Acid-d5
TRC-P786363-10MG 10 mg

Propionic Acid-d5

Sign In for Pricing
View Details
Recombinant Human PDE9A Protein (His & GST Tag)
PKSH031015 100 µg

Recombinant Human PDE9A Protein (His & GST Tag)

Sign In for Pricing
View Details
PAFAH1B2 (NM_002572) Human Over-expression Lysate
LY419243 100 µg

PAFAH1B2 (NM_002572) Human Over-expression Lysate

Sign In for Pricing
View Details
LMO2 (B-Cell Marker) (LMO2/1971), CF405S conjugate, 0.1mg/mL
BNC041971-500 1x 500 µL

LMO2 (B-Cell Marker) (LMO2/1971), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details