Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacillus velezensis UCMB5033 Chitosanase Protein

This Bacillus velezensis UCMB5033 Chitosanase Protein spans the amino acid sequence from region 37-278aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

S6FZ94

Expression Region

37-278aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bacillus velezensis UCMB5033

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGLNKDQKRRAEQLTSIFENGKTEIQYGYVEALDDGRGYTCGRAGFTTATGDALEVVEVYTKAVPNNKLKKYLPELRRLAKDESDDISNLKGFASAWRSLGNDKAFRAAQDKVNDSLYYQPAMKRSENAGLKTALAKAVMYDTVIQHGDGDDPDSFYALIKRTNKKMGGSPKDGTDEKKWLNKFLDVRYDDLMNPSDEDTQDEWRESVARVDVFRDIVKEKNYNLNGPIHVRSSEYGNFTIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF568 conjugate, 0.1mg/mL
BNC682897-500 1x 500 µL

Major Vault Protein (MVP) (VP2897R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF568 conjugate, 0.1mg/mL
BNC682345-100 1x 100 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details