Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mal-059 Protein

This Mal-059 Protein spans the amino acid sequence from region 1-145aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(pK145R)

UniProt

P0CA49

Expression Region

1-145aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDHYLKKLEDIYKKLEGHPFLFSPSKTNEKEFITLLNQALASTQLYRSIQQLFLTMYKLDPIGFINYIKTSKQEYLCLLINPKLVTKFLKITSFKIYINFRLKTFYISPNKYNNFYTAPSEEKANHLLKEEKTWAKIVEEGGEES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lymphocytes Rabbit Polyclonal Antibody
AP31643SU-N 1 mL

Lymphocytes Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
iNOS (NOS2) Mouse Monoclonal Antibody [Clone ID: OTI3H7]
TA813521S 30 µL

iNOS (NOS2) Mouse Monoclonal Antibody [Clone ID: OTI3H7]

Sign In for Pricing
View Details
Zuclopenthixol
TRC-Z701485-1MG 1 mg

Zuclopenthixol

Sign In for Pricing
View Details
WDR21B (DCAF4L1) (NM_001029955) Human Over-expression Lysate
LY422271 100 µg

WDR21B (DCAF4L1) (NM_001029955) Human Over-expression Lysate

Sign In for Pricing
View Details
WDR4 (NM_033661) Human Recombinant Protein
TP317569L 1 mg

WDR4 (NM_033661) Human Recombinant Protein

Sign In for Pricing
View Details
CD134, Mouse (OX40) (OX-86), 1mg/mL
BNUM2004-50 1x 50 µL

CD134, Mouse (OX40) (OX-86), 1mg/mL

Sign In for Pricing
View Details