Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xenopus rpl36 Protein

This Xenopus rpl36 Protein spans the amino acid sequence from region 1-105aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6DER2

Expression Region

1-105aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAIRYPMAVGLNKGHRVTKNVTKPRHCRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRIGTHIRAKRKREELSNVLAAMRKAAAKKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dextrose
S2123-500mg 500 mg

Dextrose

Sign In for Pricing
View Details
RBL1, Phosphorylated (Ser975) (RB-like 1, Retinoblastoma-like Protein 1, 107kD Retinoblastoma-associated Protein, PRB1, P107) (PE)
MBS6497051-01 0.2 mL

RBL1, Phosphorylated (Ser975) (RB-like 1, Retinoblastoma-like Protein 1, 107kD Retinoblastoma-associated Protein, PRB1, P107) (PE)

Sign In for Pricing
View Details
RBL1, Phosphorylated (Ser975) (RB-like 1, Retinoblastoma-like Protein 1, 107kD Retinoblastoma-associated Protein, PRB1, P107) (PE)
MBS6497051-02 5x 0.2 mL

RBL1, Phosphorylated (Ser975) (RB-like 1, Retinoblastoma-like Protein 1, 107kD Retinoblastoma-associated Protein, PRB1, P107) (PE)

Sign In for Pricing
View Details
Laminin gamma 1 Rabbit Monoclonal Antibody, 1 pack = 100 µL
BAL5883 1 Each

Laminin gamma 1 Rabbit Monoclonal Antibody, 1 pack = 100 µL

Sign In for Pricing
View Details
IKKB, Phosphorylated (S697) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 550)
MBS6309757-01 0.1 mL

IKKB, Phosphorylated (S697) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 550)

Sign In for Pricing
View Details
IKKB, Phosphorylated (S697) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 550)
MBS6309757-02 5x 0.1 mL

IKKB, Phosphorylated (S697) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 550)

Sign In for Pricing
View Details