Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xenopus rpl36 Protein

This Xenopus rpl36 Protein spans the amino acid sequence from region 1-105aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6DER2

Expression Region

1-105aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAIRYPMAVGLNKGHRVTKNVTKPRHCRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRIGTHIRAKRKREELSNVLAAMRKAAAKKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHX9 (NM_001014434) Human Tagged ORF Clone
RC211424 10 µg

LHX9 (NM_001014434) Human Tagged ORF Clone

Sign In for Pricing
View Details
CD31 (PECAM-1, Platelet gpIIa Molecule) (APC) discontinued, see C2383-21
C2383-22-APC 100 µL

CD31 (PECAM-1, Platelet gpIIa Molecule) (APC) discontinued, see C2383-21

Sign In for Pricing
View Details
v-SNARE Vti1a Polyclonal Antibody
JOT-AP09560-01 20 µL

v-SNARE Vti1a Polyclonal Antibody

Sign In for Pricing
View Details
v-SNARE Vti1a Polyclonal Antibody
JOT-AP09560-02 50 μL

v-SNARE Vti1a Polyclonal Antibody

Sign In for Pricing
View Details
v-SNARE Vti1a Polyclonal Antibody
JOT-AP09560-03 100 µL

v-SNARE Vti1a Polyclonal Antibody

Sign In for Pricing
View Details
Rat LDLR chaperone MESD (MESDC2) ELISA Kit
EK9684 48 Tests

Rat LDLR chaperone MESD (MESDC2) ELISA Kit

Sign In for Pricing
View Details