Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Active Protein

This Human Active Protein spans the amino acid sequence from region 23-328aa (IL12B) & 23-219aa (IL12A) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cytotoxic lymphocyte maturation factor) (CLMF) (IL-12) (NK cell stimulatory factor) (NKSF)

UniProt

P29460, P29459

Expression Region

23-328aa (IL12B) &23-219aa (IL12A)

Tag

C-terminal 10xHis-tagged & C-terminal Flag-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/ml/mL can bind Anti-IL12/IL23 recombinant antibody, the EC50 is 1.042-1.545 ng/mL.

Form

Lyophilized powder

Molecular Weight

39.7 kDa & 27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastrokine 2 (GKN2) (NM_182536) Human Tagged ORF Clone
RG216995 10 µg

Gastrokine 2 (GKN2) (NM_182536) Human Tagged ORF Clone

Sign In for Pricing
View Details
WDR72 Rabbit pAb
MBS9146011-01 0.02 mL

WDR72 Rabbit pAb

Sign In for Pricing
View Details
WDR72 Rabbit pAb
MBS9146011-02 0.1 mL

WDR72 Rabbit pAb

Sign In for Pricing
View Details
WDR72 Rabbit pAb
MBS9146011-03 5x 0.1 mL

WDR72 Rabbit pAb

Sign In for Pricing
View Details
Porcine SDF1 ELISA Kit
EPS0074 96 Tests

Porcine SDF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Annexin V Antibody (03) [CoraFluor 1]
NBP3-30742CL1 0.1 mL

Mouse Monoclonal Annexin V Antibody (03) [CoraFluor 1]

Sign In for Pricing
View Details