Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD93 Protein

This CD93 Protein spans the amino acid sequence from region 24-581aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A2K5VH53

Expression Region

24-581aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CD93 at 2 μg/ml can bind Anti-CD93 recombinant antibody, the EC50 is 0.1669-0.3513 ng/mL.

Form

Lyophilized powder

Molecular Weight

60.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCIPGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGSFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTEGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFRCGCLPGWVLAPNGVSCAMGPVSLGPPSGPPDEEYKGEREGSTVPPAATASPTRGPEGTPKSTPTTRRPLLSSDAPITSVPLEVLAPSGSPGLWREPSIHHTTAASGAQEPAGGDSSVATQNDDGTDGQKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DLL4 Antibody, Rabbit Polyclonal
MBS8111862-01 0.1 mL

Anti-DLL4 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-DLL4 Antibody, Rabbit Polyclonal
MBS8111862-02 5x 0.1 mL

Anti-DLL4 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (pebA)
MBS1198952-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (pebA)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (pebA)
MBS1198952-02 0.1 mg (E-Coli)

Recombinant Prochlorococcus marinus 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (pebA)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (pebA)
MBS1198952-03 0.02 mg (Yeast)

Recombinant Prochlorococcus marinus 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (pebA)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (pebA)
MBS1198952-04 0.1 mg (Yeast)

Recombinant Prochlorococcus marinus 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (pebA)

Sign In for Pricing
View Details