Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VSIG4 Protein

This Human VSIG4 Protein spans the amino acid sequence from region 20-283aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein Z39Ig)

UniProt

Q9Y279

Expression Region

20-283aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ml can bind Anti-VSIG4 recombinant antibody, the EC50 is 51.14-68.73 ng/mL.

Form

Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (APC)
MBS6284051-01 0.2 mL

CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (APC)

Sign In for Pricing
View Details
CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (APC)
MBS6284051-02 5x 0.2 mL

CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (APC)

Sign In for Pricing
View Details
Recombinant Escherichia coli Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1008006-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details
Recombinant Escherichia coli Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1008006-02 0.02 mg (Yeast)

Recombinant Escherichia coli Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details
Recombinant Escherichia coli Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1008006-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details
Recombinant Escherichia coli Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1008006-04 0.1 mg (Yeast)

Recombinant Escherichia coli Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details