Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL17A Protein

This Human IL17A Protein spans the amino acid sequence from region 24-155aa (T26A) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8)

UniProt

Q16552

Expression Region

24-155aa (T26A)

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human IL17A at 2 μg/ml can bind Anti-IL17A recombinant antibody, the EC50 is 1.818-2.170 ng/mL.

Form

Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

GIAIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GelHP Protein Gel (Tris-Gly, 15%, 10 well)
HY-K1115 10 PCS

GelHP Protein Gel (Tris-Gly, 15%, 10 well)

Sign In for Pricing
View Details
AAAS Adenovirus (Mouse)
10980054 1.0 mL

AAAS Adenovirus (Mouse)

Sign In for Pricing
View Details
CC2D2A siRNA (Human)
MBS8203541-01 15 nmol

CC2D2A siRNA (Human)

Sign In for Pricing
View Details
CC2D2A siRNA (Human)
MBS8203541-02 30 nmol

CC2D2A siRNA (Human)

Sign In for Pricing
View Details
CC2D2A siRNA (Human)
MBS8203541-03 5x 30 nmol

CC2D2A siRNA (Human)

Sign In for Pricing
View Details
200µl Universal Grad tip, Sterile, Filter
GT-200-S-F-R 96 Tips x 10 Green Racks x 10 Packs

200µl Universal Grad tip, Sterile, Filter

Sign In for Pricing
View Details