Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLP1R Protein

This Human GLP1R Protein spans the amino acid sequence from region 24-145aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GLP-1 receptor) (GLP-1-R) (GLP-1R)

UniProt

P43220

Expression Region

24-145aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody, the EC50 is 54.54-94.23 ng/mL.

Form

Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse S100 Calcium Binding Protein B/S100B (C-6His)
CK82-50ug 50 µg

Recombinant Mouse S100 Calcium Binding Protein B/S100B (C-6His)

Sign In for Pricing
View Details
RERG (NM_032918) Human Recombinant Protein
PH40270M5 20 µg

RERG (NM_032918) Human Recombinant Protein

Sign In for Pricing
View Details
Vmn1r81 Mouse shRNA Plasmid (Locus ID 171244)
TL515760 1 Kit

Vmn1r81 Mouse shRNA Plasmid (Locus ID 171244)

Sign In for Pricing
View Details
Sycp2l 3'UTR Lenti-reporter-Luc Vector
45949086 1.0 µg

Sycp2l 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse LKB1 Ready-To-Use IHC Kit
orb1817103 50 Tests

Mouse LKB1 Ready-To-Use IHC Kit

Sign In for Pricing
View Details
PAX6 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-11204R-APC-Cy5.5 100 µL

PAX6 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details