Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB5/CD85c/LIR-8, Human (HEK293, His)

The LILRB5/CD85c/LIR-8 protein functions as a receptor for class I MHC antigens, suggesting a critical role in immune recognition and regulation. Its interaction with MHC class I molecules suggests involvement in surveillance and may influence immune responses. LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His) is the recombinant human-derived LILRB5/CD85c/LIR-8 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb5-cd85c-lir-8-protein-human-hek-293-his.html

Purity

99.90

Smiles

GTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRH

Molecular Formula

10990 (Gene_ID) O75023-1 (G24-H456) (Accession)

Molecular Weight

Approximately 72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGP2 antibody
70R-15290 100 ug

AGP2 antibody

Sign In for Pricing
View Details
Anti-AMPK alpha 1/2 (pT183/172) Antibody
MBS8605282-01 0.1 mg

Anti-AMPK alpha 1/2 (pT183/172) Antibody

Sign In for Pricing
View Details
Anti-AMPK alpha 1/2 (pT183/172) Antibody
MBS8605282-02 0.1 mL (AF635)

Anti-AMPK alpha 1/2 (pT183/172) Antibody

Sign In for Pricing
View Details
Anti-AMPK alpha 1/2 (pT183/172) Antibody
MBS8605282-03 0.1 mL (AF610)

Anti-AMPK alpha 1/2 (pT183/172) Antibody

Sign In for Pricing
View Details
Anti-AMPK alpha 1/2 (pT183/172) Antibody
MBS8605282-04 0.1 mL (AF405S)

Anti-AMPK alpha 1/2 (pT183/172) Antibody

Sign In for Pricing
View Details
Anti-AMPK alpha 1/2 (pT183/172) Antibody
MBS8605282-05 0.1 mL (AF405L)

Anti-AMPK alpha 1/2 (pT183/172) Antibody

Sign In for Pricing
View Details