Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukemia inhibitory factor (LIF)

Product Specifications

Product Name Alternative

LIF; Differentiation-stimulating factor; D factor; Melanoma-derived LPL inhibitor; MLPLI; Emfilermin

Abbreviation

Recombinant Human LIF protein

Gene Name

LIF

UniProt

P15018

Expression Region

23-202aa

Organism

Homo sapiens (Human)

Target Sequence

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spef1 Mouse Gene Knockout Kit (CRISPR)
KN516589 1 Kit

Spef1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(1S)-(-)-Alpha-Pinene-D3
TRC-P466612-25MG 25 mg

(1S)-(-)-Alpha-Pinene-D3

Sign In for Pricing
View Details
DYKDDDDK Tag ( FLAG ) Mouse Monoclonal Antibody [A2-A4]
M1403-2 100 µL

DYKDDDDK Tag ( FLAG ) Mouse Monoclonal Antibody [A2-A4]

Sign In for Pricing
View Details
3'-Dehydrolutein (~90%)
TRC-D229755-25MG 25 mg

3'-Dehydrolutein (~90%)

Sign In for Pricing
View Details
Cyclin B1 (V92.1), CF640R conjugate, 0.1mg/mL
BNC400680-500 1x 500 µL

Cyclin B1 (V92.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details