Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-alpha 1b/IFNA13, Human

IFN-alpha 1/13 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway[4], exerts function by inhibiting viral replication as well as modulating immune response[3]. IFN-alpha 1b/IFNA13 Protein, Human contains 166 a.a. (C24-D189, A137V), produced in E. coli cells with tag free.

Product Specifications

Product Name Alternative

IFN-alpha 1b/IFNA13 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-alpha-13-ifna1-protein-human.html

Purity

96.00

Smiles

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Molecular Formula

3439/3447 (Gene_ID) P01562 (C24-E189, A137V) (Accession)

Molecular Weight

Approximately 19.5 kDa

References & Citations

[1]Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27 (2) :240-52.|[2]Zhang SY, et al. Inborn errors of interferon (IFN) -mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.|[3]Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266 (17) :11360-5.|[4]van Pesch V, et al. Characterization of interferon-alpha 13, a novel constitutive murine interferon-alpha subtype. J Biol Chem. 2003 Nov 21;278 (47) :46321-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphA10 Antibody
MBS9412213-01 0.1 mL

EphA10 Antibody

Sign In for Pricing
View Details
EphA10 Antibody
MBS9412213-02 5x 0.1 mL

EphA10 Antibody

Sign In for Pricing
View Details
MIPOL 1 (MIPOL1) (NM_138731) Human Over-expression Lysate
LS145282-20ug 20 µg

MIPOL 1 (MIPOL1) (NM_138731) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Monoclonal FGFR4 Antibody (249)
NBP2-89557-50ul 50 µL

Rabbit Monoclonal FGFR4 Antibody (249)

Sign In for Pricing
View Details
Rabbit Anti-Human CHRM5 pAb
PA9979-01 50 μL

Rabbit Anti-Human CHRM5 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human CHRM5 pAb
PA9979-02 100 μL

Rabbit Anti-Human CHRM5 pAb

Sign In for Pricing
View Details