Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-alpha 1b/IFNA13, Human

IFN-alpha 1/13 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway[4], exerts function by inhibiting viral replication as well as modulating immune response[3]. IFN-alpha 1b/IFNA13 Protein, Human contains 166 a.a. (C24-D189, A137V), produced in E. coli cells with tag free.

Product Specifications

Product Name Alternative

IFN-alpha 1b/IFNA13 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-alpha-13-ifna1-protein-human.html

Purity

96.00

Smiles

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Molecular Formula

3439/3447 (Gene_ID) P01562 (C24-E189, A137V) (Accession)

Molecular Weight

Approximately 19.5 kDa

References & Citations

[1]Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27 (2) :240-52.|[2]Zhang SY, et al. Inborn errors of interferon (IFN) -mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.|[3]Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266 (17) :11360-5.|[4]van Pesch V, et al. Characterization of interferon-alpha 13, a novel constitutive murine interferon-alpha subtype. J Biol Chem. 2003 Nov 21;278 (47) :46321-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS8 Rabbit Polyclonal Antibody
TA420980 100 µg

PRSS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Interferon Gamma (IFNg) BioAssayTM ECL ELISA Kit (Guinea Pig)
157813 96 Tests

Interferon Gamma (IFNg) BioAssayTM ECL ELISA Kit (Guinea Pig)

Sign In for Pricing
View Details
Nlrc3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4784904 1.0 µg DNA

Nlrc3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Eukaryotic translation initiation factor 3
MF-0038218-01 1 mg

Eukaryotic translation initiation factor 3

Sign In for Pricing
View Details
Eukaryotic translation initiation factor 3
MF-0038218-02 5 mg

Eukaryotic translation initiation factor 3

Sign In for Pricing
View Details
Eukaryotic translation initiation factor 3
MF-0038218-03 10 mg

Eukaryotic translation initiation factor 3

Sign In for Pricing
View Details