Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gastrin-71, Mouse (HEK293, Fc)

Gastrin-71 protein acts as a potent stimulator of various physiological processes. It activates the gastric mucosa, promotes the production and secretion of hydrochloric acid, and induces the release of digestive enzymes from the pancreas. Gastrin-71 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Gastrin-71 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Gastrin-71 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gastrin-71-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

SWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDF

Molecular Formula

14459 (Gene_ID) P48757 (S22-F92) (Accession)

Molecular Weight

Approximately 38-43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKD1/PKC mu Rabbit pAb, PE-Cy5.5 conjugated
orb2820309 100 µL

PRKD1/PKC mu Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
N-(1,3,4-Thiadiazolyl)nicotinamide
TRC-T344000-5MG 5 mg

N-(1,3,4-Thiadiazolyl)nicotinamide

Sign In for Pricing
View Details
CFI Polyclonal Antibody
MBS9127508-01 0.02 mL

CFI Polyclonal Antibody

Sign In for Pricing
View Details
CFI Polyclonal Antibody
MBS9127508-02 0.1 mL

CFI Polyclonal Antibody

Sign In for Pricing
View Details
CFI Polyclonal Antibody
MBS9127508-03 5x 0.1 mL

CFI Polyclonal Antibody

Sign In for Pricing
View Details
TUBB1 Rabbit Polyclonal Antibody
orb514311 100 µg

TUBB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details