Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD7 protein

This Human CD7 protein [Out of Stock] spans the amino acid sequence from region 26-180aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD7, CD7 antigen (p41), CD7 antigen, CD7 molecule, CD7_HUMAN, GP40, LEU 9, LEU9, p41 protein, T cell antigen CD7, T cell leukemia antigen , T cell surface antigen Leu 9, T-cell antigen CD7, T-cell leukemia antigen, T-cell surface antigen Leu-9, Tp 40, Tp40, TP41

UniProt

P09564

Expression Region

26-180aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2K2 Recombinant Protein (Human)
RP018724 100 µg

MAP2K2 Recombinant Protein (Human)

Sign In for Pricing
View Details
SMARCE1 Protein Vector (Human) (pPB-N-His)
PV039174 500 ng

SMARCE1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
DPP4 Polyclonal Conjugated Antibody
MBS9440215-01 0.1 mL (Biotin)

DPP4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DPP4 Polyclonal Conjugated Antibody
MBS9440215-02 0.1 mL (AF350)

DPP4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DPP4 Polyclonal Conjugated Antibody
MBS9440215-03 0.1 mL (AF405)

DPP4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DPP4 Polyclonal Conjugated Antibody
MBS9440215-04 0.1 mL (AF488)

DPP4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details