Carbonic Anhydrase 13, Human (His)
Carbonic Anhydrase 13 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Human Carbonic Anhydrase 13, a member of the human carbonic anhydrase (hCA), can control pH and ion balance regulation[1].
Product Specifications
Product Name Alternative
Carbonic Anhydrase 13 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carbonic-anhydrase-13-protein-human-his.html
Purity
98.0
Smiles
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFHHHHHHH
Molecular Formula
377677 (Gene_ID) Q8N1Q1 (M1-F261) (Accession)
Molecular Weight
Approximately 32.0 kDa
References & Citations
[1]Anna Di Fiore, et al. Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide. Proteins. 2009 Jan;74 (1) :164-75.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC424465 20 µg
Mineralocorticoid Receptor (NR3C2) (NM_000901) Human Over-expression Lysate
Sign In for Pricing
View Details ![RNF11 Mouse Monoclonal Antibody [Clone ID: OTI1G10]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908a17/imageurl/cf811049.webp)
CF811049 100 µg
RNF11 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
Sign In for Pricing
View Details 