Human Interferon gamma Protein
Recombinant of Human Interferon gamma protein
Product Specifications
Product Name Alternative
AIF-1, Allograft inflammatory factor 1, Em:AF129756.17, G1, IBA1, Ionized calcium-binding adapter molecule 1, IRT-1, Protein G1, AIF1.
Source
E. Coli
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS PAGE.
Form
Filtered White lyophilized (freeze-dried) powder.
Solubility
Add deionized water and let the lyophilized pellet dissolve completely.
Storage Conditions
Stability: For long term, store lyophilized AIF1 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.The lyophilized protein remains stable for 24 months when stored at -20°C
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
Filtered and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl pH-7.5.
AA Sequence
MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
