Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP 7 Protein

Recombinant of human, plant BMP 7 protein

Product Specifications

Product Name Alternative

Osteogenic Protein 1, BMP-7.

Source

Nicotiana benthamiana

Purity

Greater than 97.0% as determined by SDS-PAGE.

Bioactivity

The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/μl.

Storage Conditions

Stability: Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.

AA Sequence

HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARVA rabbit pAb
RA33993-01 50 µL

PARVA rabbit pAb

Sign In for Pricing
View Details
PARVA rabbit pAb
RA33993-02 100 µL

PARVA rabbit pAb

Sign In for Pricing
View Details
Mouse Lincmd1 Pre-designed siRNA Set A
SI107577A 1 Each

Mouse Lincmd1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
RNF214
333005-01 50 µL

RNF214

Sign In for Pricing
View Details
RNF214
333005-02 100 µL

RNF214

Sign In for Pricing
View Details
PLAST SYRINGE. s.ago ML 50 LUER LOCK (RR) cf. 50
11352545 1 Each

PLAST SYRINGE. s.ago ML 50 LUER LOCK (RR) cf. 50

Sign In for Pricing
View Details