Human BMP 7 Protein
Recombinant of human, plant BMP 7 protein
Product Specifications
Product Name Alternative
Osteogenic Protein 1, BMP-7.
Source
Nicotiana benthamiana
Purity
Greater than 97.0% as determined by SDS-PAGE.
Bioactivity
The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/μl.
Storage Conditions
Stability: Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
AA Sequence
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TMPY-06514-02 10 µg
Nectin-4 Protein, Cynomolgus, Recombinant (His)
Sign In for Pricing
View Details TMPY-06514-03 20 µg
Nectin-4 Protein, Cynomolgus, Recombinant (His)
Sign In for Pricing
View Details TMPY-06514-04 50 µg
Nectin-4 Protein, Cynomolgus, Recombinant (His)
Sign In for Pricing
View Details TMPY-06514-05 100 µg
Nectin-4 Protein, Cynomolgus, Recombinant (His)
Sign In for Pricing
View Details TMPY-06514-06 200 µg
Nectin-4 Protein, Cynomolgus, Recombinant (His)
Sign In for Pricing
View Details