Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTF Protein

Recombinant of CNTF protein

Product Specifications

Product Name Alternative

HCNTF, CNTF, Ciliary Neurotrophic Factor.

Source

Escherichia Coli

Purity

Greater than 99.0% as determined by: (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.

Bioactivity

Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100μg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.

Storage Conditions

Stability: Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3.

AA Sequence

AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Mouse CD18 Antibody
MBS4514895-01 0.05 mg

Purified Anti-Mouse CD18 Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse CD18 Antibody
MBS4514895-02 0.1 mg

Purified Anti-Mouse CD18 Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse CD18 Antibody
MBS4514895-03 5x 0.1 mg

Purified Anti-Mouse CD18 Antibody

Sign In for Pricing
View Details
4930469G21Rik ORF Vector (Mouse) (pORF)
10637014 1.0 µg DNA

4930469G21Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
MMP9 siRNA (Human)
MBS8213555-01 15 nmol

MMP9 siRNA (Human)

Sign In for Pricing
View Details
MMP9 siRNA (Human)
MBS8213555-02 30 nmol

MMP9 siRNA (Human)

Sign In for Pricing
View Details