What is the catalog number for CNTF Protein?

The catalog number for CNTF Protein is orb424833.

What sizes are available for CNTF Protein?

CNTF Protein is available in the following size(s): 5 µg, 25 µg, 1 mg.

How many pack sizes does CNTF Protein come in?

CNTF Protein is available in 3 different pack sizes.

Is CNTF Protein in stock?

CNTF Protein is currently made to order / not held in immediate stock. Contact us for lead time.

CNTF Protein

Recombinant of CNTF protein

Product Specifications

Product Name Alternative

HCNTF, CNTF, Ciliary Neurotrophic Factor.

Source

Escherichia Coli

Purity

Greater than 99.0% as determined by: (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.

Bioactivity

Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100μg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.

Storage Conditions

Stability: Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3.

AA Sequence

AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM