Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish GH Protein

Recombinant of fish GH protein

Product Specifications

Product Name Alternative

GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) in 0.4% NaHCO3 or water adjusted to pH 8-9, not less than 100μg/ml and not more than 3mg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.

Storage Conditions

Stability: Lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3. Adjusted to pH-8.

AA Sequence

AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Embedding Cassettes
SL-EC-BP-S-0.9x0.9-I 250 PCS/Box, 8 Boxes/CTN

Embedding Cassettes

Sign In for Pricing
View Details
SW 1353 Cell Line, BioGenomicsTM discontinued
551086 1x10e6 cells/vial

SW 1353 Cell Line, BioGenomicsTM discontinued

Sign In for Pricing
View Details
FHIT discontinued
389151 200 µL

FHIT discontinued

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Aggrecan (AGC)
MBS2060489-01 0.1 mL

APC-Linked Polyclonal Antibody to Aggrecan (AGC)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Aggrecan (AGC)
MBS2060489-02 0.2 mL

APC-Linked Polyclonal Antibody to Aggrecan (AGC)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Aggrecan (AGC)
MBS2060489-03 0.5 mL

APC-Linked Polyclonal Antibody to Aggrecan (AGC)

Sign In for Pricing
View Details