Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit GHBP Protein

Recombinant of rabbit GHBP protein

Product Specifications

Product Name Alternative

GHR, GHBP, GH receptor, Somatotropin receptor.

Source

Escherichia Coli

Purity

Greater than 98.0% as determined bySDS-PAGE.

Bioactivity

Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP Rabbit should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1mg/ml) solution with 0.0045mM NaHCO3.

AA Sequence

AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-n- (2,6-dichlorophenyl) propanamide
417097-01 100 mg

2-Chloro-n- (2,6-dichlorophenyl) propanamide

Sign In for Pricing
View Details
2-Chloro-n- (2,6-dichlorophenyl) propanamide
417097-02 250 mg

2-Chloro-n- (2,6-dichlorophenyl) propanamide

Sign In for Pricing
View Details
EIF2AK1 (HRP)
561276-01 50 µg

EIF2AK1 (HRP)

Sign In for Pricing
View Details
EIF2AK1 (HRP)
561276-02 100 µg

EIF2AK1 (HRP)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Annexin A1 (ANXA1)
MBS2136595-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Annexin A1 (ANXA1)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Annexin A1 (ANXA1)
MBS2136595-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Annexin A1 (ANXA1)

Sign In for Pricing
View Details