Human IFN a 2a Protein
Recombinant of human IFN a 2a protein
Product Specifications
Product Name Alternative
Leukocyte IFN, B cell IFN, Type I IFN, IFNA2, IFN-a 2a, Interferon-alpha-2a.
Source
Escherichia Coli
Field of Research
Infectious Disease & Virology
Purity
Greater than 97.0% as determined by both: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 270,000,000 IU/mg.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized Interferon-alpha-2a in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized IFNA-2A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN-alpha 2a should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Protein content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.924 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics) . 2. Analysis by RP-HPLC, using a calibrated solution of IFN-a 2a as a Reference Standard
Preservative
Lyophilized without additives.
AA Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEM IQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE. N-terminal methionine has been completely removed enzymatically
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1420423-01 0.05 mg (E-Coli)
Recombinant Emericella nidulans Ubiquinone biosynthesis protein coq4, mitochondrial (coq4)
Sign In for Pricing
View Details MBS1420423-02 0.05 mg (Yeast)
Recombinant Emericella nidulans Ubiquinone biosynthesis protein coq4, mitochondrial (coq4)
Sign In for Pricing
View Details MBS1420423-03 0.2 mg (E-Coli)
Recombinant Emericella nidulans Ubiquinone biosynthesis protein coq4, mitochondrial (coq4)
Sign In for Pricing
View Details MBS1420423-04 0.05 mg (Baculovirus)
Recombinant Emericella nidulans Ubiquinone biosynthesis protein coq4, mitochondrial (coq4)
Sign In for Pricing
View Details MBS1420423-05 0.5 mg (E-Coli)
Recombinant Emericella nidulans Ubiquinone biosynthesis protein coq4, mitochondrial (coq4)
Sign In for Pricing
View Details MBS1420423-06 0.2 mg (Yeast)
Recombinant Emericella nidulans Ubiquinone biosynthesis protein coq4, mitochondrial (coq4)
Sign In for Pricing
View Details