What is the catalog number for Human IFN a 2a Protein?

The catalog number for Human IFN a 2a Protein is orb426358.

What sizes are available for Human IFN a 2a Protein?

Human IFN a 2a Protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human IFN a 2a Protein come in?

Human IFN a 2a Protein is available in 3 different pack sizes.

Is Human IFN a 2a Protein in stock?

Human IFN a 2a Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human IFN a 2a Protein

Recombinant of human IFN a 2a protein

Product Specifications

Product Name Alternative

Leukocyte IFN, B cell IFN, Type I IFN, IFNA2, IFN-a 2a, Interferon-alpha-2a.

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 97.0% as determined by both: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 270,000,000 IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Interferon-alpha-2a in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized IFNA-2A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN-alpha 2a should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Protein content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.924 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics) . 2. Analysis by RP-HPLC, using a calibrated solution of IFN-a 2a as a Reference Standard

Preservative

Lyophilized without additives.

AA Sequence

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEM IQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE. N-terminal methionine has been completely removed enzymatically