Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant IGF1 Gilthead Protein

Recombinant of Plant IGF1 Gilthead protein

Product Specifications

Product Name Alternative

Somatomedin C, IGF-I, IGFI.

Source

Escherichia Coli

Purity

Greater than 98.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Binding assays of the 125I-Gealthead Seabream IGF1 to Gilthead Seabream or carp (Cyprinus carpio) sera resulted in high specific binding, indicating the existence of one or more IGF-binding proteins. In binding experiments to crude Gilthead Seabream brain homogenate, using human (h) IGF-I as a ligand, the respective IC50 value of hIGF1 was about fourfold lower than that of Gilthead Seabream IGF-1. Recombinant Gilthead Seabream IGF-1 exhibited mitogenic activity in a mouse mammary gland-derived MME-L1 cell line which was approximately 200-fold lower than that of hIGF1. Binding experiments to intact MME-L1 cells suggests that this difference most likely results from a correspondingly lower affinity for IGF1 receptor in these cells. In contrast, the activities of Gilthead Seabream IGF-I and hIGF-I measured by 35S uptake by gill arches from the goldfish (Carassius auratus) were identical, indicating that the recombinant Gilthead Seabream IGF-I is biologically active.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized IGF-1 in sterile 0.4% NaHCO3 adjusted to ph 8-9, not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Protein content: Somatomedin C quantitation was carried out by two independent methods1. UV spectroscopy at 280 nm using the absorbency value of 0.60 as the extinction coefficient for a 0.1% (1mg/ml) solution at pH 8.0. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics) . 2. Analysis by RP-HPLC, using a calibrated solution of IGF1 as a Reference Standard

Preservative

The protein was lyophilized from a concentrated (1mg/ml) solution with 0.02% NaHCO3.

AA Sequence

MSPETLCGAELVDTLQFVCGERGFYFSKPGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB11 Mouse Monoclonal Antibody [Clone ID: OTI8C5]
CF807693 100 µg

NDUFB11 Mouse Monoclonal Antibody [Clone ID: OTI8C5]

Sign In for Pricing
View Details
CD41a (ITGA2B/1036), CF568 conjugate, 0.1mg/mL
BNC681036-500 1x 500 µL

CD41a (ITGA2B/1036), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2-Dihydroxymelatonin (>80%)
TRC-D453470-1G 1 g

1,2-Dihydroxymelatonin (>80%)

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3495), CF405S conjugate, 0.1mg/mL
BNC043495-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3495), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1orf124 (SPRTN) Rabbit Polyclonal Antibody
TA381963 100 µL

C1orf124 (SPRTN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX10 (SOX10/992), CF568 conjugate, 0.1mg/mL
BNC680992-100 1x 100 µL

SOX10 (SOX10/992), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details