Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL 1 alpha Protein

Recombinant of human IL1 alpha protein

Product Specifications

Product Name Alternative

Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL-1 alpha, IL1, IL-1A, IL1F1.

Source

Escherichia Coli

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1 x 109 IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Interleukin 1 alpha in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Protein content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 1.13 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics) . 2. Analysis by RP-HPLC, using a standard solution of IL-1 as a Reference Standard

Preservative

The protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 25mM Tris-HCl, pH 8.

AA Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf166 Polyclonal Antibody
MBS9433584-01 0.05 mL

C14orf166 Polyclonal Antibody

Sign In for Pricing
View Details
C14orf166 Polyclonal Antibody
MBS9433584-02 0.1 mL

C14orf166 Polyclonal Antibody

Sign In for Pricing
View Details
C14orf166 Polyclonal Antibody
MBS9433584-03 5x 0.1 mL

C14orf166 Polyclonal Antibody

Sign In for Pricing
View Details
CREG1 Rabbit Polyclonal Antibody
orb1374-01 50 μL

CREG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CREG1 Rabbit Polyclonal Antibody
orb1374-02 100 µL

CREG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CREG1 Rabbit Polyclonal Antibody
orb1374-03 200 µL

CREG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details