What is the catalog number for Human IL 1 beta (His) Protein?

The catalog number for Human IL 1 beta (His) Protein is orb426418.

What sizes are available for Human IL 1 beta (His) Protein?

Human IL 1 beta (His) Protein is available in the following size(s): 5 µg, 20 µg, 1 mg.

How many pack sizes does Human IL 1 beta (His) Protein come in?

Human IL 1 beta (His) Protein is available in 3 different pack sizes.

Is Human IL 1 beta (His) Protein in stock?

Human IL 1 beta (His) Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human IL 1 beta (His) Protein

Recombinant of human IL 1 beta (His) protein

Product Specifications

Product Name Alternative

Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered clear solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

IL-1b His tag protein solution is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS