Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL 1 beta (His) Protein

Recombinant of human IL 1 beta (His) protein

Product Specifications

Product Name Alternative

Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered clear solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

IL-1b His tag protein solution is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBED4 Adenovirus (Mouse)
50679054 1.0 mL

ZBED4 Adenovirus (Mouse)

Sign In for Pricing
View Details
Clstn1 ORF Vector (Rat) (pORF)
ORF065153 1.0 µg DNA

Clstn1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
DUX4 Rabbit pAb
E47R12369 100 µL

DUX4 Rabbit pAb

Sign In for Pricing
View Details
3,6-Di-O-benzoyl-D-galactal
GC3689-250mg 250 mg

3,6-Di-O-benzoyl-D-galactal

Sign In for Pricing
View Details
CLC4E rabbit pAb
RA31669-01 50 µL

CLC4E rabbit pAb

Sign In for Pricing
View Details
CLC4E rabbit pAb
RA31669-02 100 µL

CLC4E rabbit pAb

Sign In for Pricing
View Details