Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL 1 beta (His) Protein

Recombinant of human IL 1 beta (His) protein

Product Specifications

Product Name Alternative

Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered clear solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

IL-1b His tag protein solution is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Izumo4 Mouse Pre-designed siRNA Set A
HY-RS19783 1 Set

Izumo4 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Goat Anti-Interleukin 21 ELISA Kit
MBS7274319-01 48 Well

Goat Anti-Interleukin 21 ELISA Kit

Sign In for Pricing
View Details
Goat Anti-Interleukin 21 ELISA Kit
MBS7274319-02 96 Well

Goat Anti-Interleukin 21 ELISA Kit

Sign In for Pricing
View Details
Goat Anti-Interleukin 21 ELISA Kit
MBS7274319-03 5x 96 Well

Goat Anti-Interleukin 21 ELISA Kit

Sign In for Pricing
View Details
Goat Anti-Interleukin 21 ELISA Kit
MBS7274319-04 10x 96 Well

Goat Anti-Interleukin 21 ELISA Kit

Sign In for Pricing
View Details
Cleaved-MMP-3 (F100) Rabbit Polyclonal Antibody
E28PC0066 100 µL

Cleaved-MMP-3 (F100) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details