Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL 1 beta (His) Protein

Recombinant of human IL 1 beta (His) protein

Product Specifications

Product Name Alternative

Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered clear solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

IL-1b His tag protein solution is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anpirtoline hydrochloride
B6410-50 50 mg

Anpirtoline hydrochloride

Sign In for Pricing
View Details
FERD3L Antibody, FITC conjugated
CSB-PA850424LC01HU-01 50 µg

FERD3L Antibody, FITC conjugated

Sign In for Pricing
View Details
FERD3L Antibody, FITC conjugated
CSB-PA850424LC01HU-02 100 µg

FERD3L Antibody, FITC conjugated

Sign In for Pricing
View Details
2-Nitroaniline-4-sulfonic acid sodium salt
sc-283241A 500 g

2-Nitroaniline-4-sulfonic acid sodium salt

Sign In for Pricing
View Details
Slc35c1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6719007 1.0 µg DNA

Slc35c1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Mouse Mediator Of RNA Polymerase II Transcription Subunit 7 (MED7) ELISA Kit
MBS7256197-01 48 Well

Mouse Mediator Of RNA Polymerase II Transcription Subunit 7 (MED7) ELISA Kit

Sign In for Pricing
View Details