Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL 1 beta Protein

Recombinant of Human IL 1 beta protein

Product Specifications

Product Name Alternative

Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Source

HEK

Purity

Greater than 95% as obsereved by SDS-PAGE.

Bioactivity

The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized IL-1b in sterile PBS containing 0.1% endotoxin-free recombinant HSA.

Storage Conditions

Stability: Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

The IL-1 beta was lyophilized from 1mg/ml in 1xPBS.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR3 Antibody (N-term)
orb1937398-01 50 µL

WDR3 Antibody (N-term)

Sign In for Pricing
View Details
WDR3 Antibody (N-term)
orb1937398-02 100 µL

WDR3 Antibody (N-term)

Sign In for Pricing
View Details
Recombinant Human Frizzled-3 (FZD3)
orb1785287-01 20 µg

Recombinant Human Frizzled-3 (FZD3)

Sign In for Pricing
View Details
Recombinant Human Frizzled-3 (FZD3)
orb1785287-02 100 µg

Recombinant Human Frizzled-3 (FZD3)

Sign In for Pricing
View Details
CXCL10 Antibody
orb2681207-01 50 µL

CXCL10 Antibody

Sign In for Pricing
View Details
CXCL10 Antibody
orb2681207-02 100 µL

CXCL10 Antibody

Sign In for Pricing
View Details