Human IL 1 beta Protein
Recombinant of Human IL 1 beta protein
Product Specifications
Product Name Alternative
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Source
HEK
Purity
Greater than 95% as obsereved by SDS-PAGE.
Bioactivity
The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized IL-1b in sterile PBS containing 0.1% endotoxin-free recombinant HSA.
Storage Conditions
Stability: Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
The IL-1 beta was lyophilized from 1mg/ml in 1xPBS.
AA Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
042252-ML650 100 µL
SPOP, NT (SPOP, Speckle-type POZ protein, HIB homolog 1, Roadkill homolog 1) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
GTR15180241 1 Vial
Lentiviral mouse Apol7e shRNA (UAS) - Lentiviral mouse Apol7e shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details