Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL 13 Protein

Recombinant of human IL13 protein

Product Specifications

Product Name Alternative

NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.

Source

Escherichia Coli

Purity

Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be 1 x 106units/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Protein content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.57 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics) . 2. Analysis by RP-HPLC, using a calibrated solution of IL-13 as a Reference Standard

Preservative

The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.

AA Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colestipol Hydrochloride
C14298-01 5 mg

Colestipol Hydrochloride

Sign In for Pricing
View Details
Colestipol Hydrochloride
C14298-02 25 mg

Colestipol Hydrochloride

Sign In for Pricing
View Details
ASTE1 CRISPR Activation Plasmid (h2)
sc-412016-ACT-2 20 µg

ASTE1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
GLIPR1L2 shRNA Plasmid (m)
sc-145424-SH 20 µg

GLIPR1L2 shRNA Plasmid (m)

Sign In for Pricing
View Details
NKIRAS1 Conjugated Antibody
MBS9453637-01 0.1 mL (AF350)

NKIRAS1 Conjugated Antibody

Sign In for Pricing
View Details
NKIRAS1 Conjugated Antibody
MBS9453637-02 0.1 mL (AF405)

NKIRAS1 Conjugated Antibody

Sign In for Pricing
View Details