What is the catalog number for Mouse IL17E Protein?

The catalog number for Mouse IL17E Protein is orb80456.

What sizes are available for Mouse IL17E Protein?

Mouse IL17E Protein is available in the following size(s): 5 µg, 25 µg, 1 mg.

How many pack sizes does Mouse IL17E Protein come in?

Mouse IL17E Protein is available in 3 different pack sizes.

Is Mouse IL17E Protein in stock?

Mouse IL17E Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Mouse IL17E Protein

Recombinant of Mouse IL17E protein

Product Specifications

Product Name Alternative

IL-25, IL-17E, IL17E, IL25, Interleukin-25.

Source

Escherichia Coli

Field of Research

Immunology & Inflammation

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives.

AA Sequence

VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA