Mouse IL17F Protein
Recombinant of mouse IL17F protein
Product Specifications
Product Name Alternative
Cytokine ML-1, IL-17F, Interleukin-17F precursor, IL17F, ML1, ML-1.
Source
Escherichia Coli
Field of Research
Immunology & Inflammation
Purity
Greater than 97.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives.
AA Sequence
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PA1560-carrier-free 100 µg/Vial
Anti-Transcription factor E2F1 E2F1 Antibody Picoband®, Carrier-free
Sign In for Pricing
View Details 
![4,5-Dihydro-4,5-dioxo-1H-pyrrolo[2,3-f]quinoline-2,7,9-tricarboxylic acid, 5,5-dimethyl ketal](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
272334-01 5 mg
4,5-Dihydro-4,5-dioxo-1H-pyrrolo[2,3-f]quinoline-2,7,9-tricarboxylic acid, 5,5-dimethyl ketal
Sign In for Pricing
View Details