Human IL37 Protein
Recombinant of Human IL37 protein
Product Specifications
Product Name Alternative
Interleukin-37, FIL1 zeta, IL-1X, Interleukin-1 family member 7, IL-1F7, Interleukin-1 homolog 4, IL-1H, IL-1H4, Interleukin-1 zeta, IL-1 zeta, Interleukin-1-related protein, IL-1RP1, Interleukin-23, IL-37, IL37, FIL1Z, IL1F7, IL1H4, IL1RP1, FIL1, FIL1 (ZETA) .
Source
Escherichia Coli
Field of Research
Immunology & Inflammation
Purity
Greater than 95.0% as determined by SDS-PAGE.
Bioactivity
As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 μg/ml (100 μl/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1μg/ml.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
IL37 was lyophilized from a 0.2μM filtered solution of 20mM PB, 150mM NaCl and 2mM DTT pH 7.4.
AA Sequence
MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
I7650-16T 1 mg
Influenza Virus Type A Hemagglutinin H9 discontinued
Sign In for Pricing
View Details 
