Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Leptin Protein

Recombinant of fish Leptin protein

Product Specifications

Product Name Alternative

OB Protein, Obesity Protein, OBS, Obesity factor.

Source

Escherichia Coli

Field of Research

Metabolism Research

Purity

Greater than 99.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Biological active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. The affinity of human leptin receptors is considerably lower campared to mammalian leptins.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Pufferfish Leptin in sterile 0.4% NaHCO3 pH-9 not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Pufferfish Leptin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leptin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Protein content: Protein quantitation was carried out by UV spectroscopy at 280 nm using the absorbency value of 1.28 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics)

Preservative

The Pufferfish Leptin was lyophilized from a concentrated (0.85mg/ml) solution with 0.003mM NaHCO3.

AA Sequence

ALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVE GSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQE QQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bone Morphogenetic Protein 7 (BMP7, BMP-7, OP-1, Osteogenic Protein 1, Eptotermin alfa, OP1) discontinued
029738 100 µg

Bone Morphogenetic Protein 7 (BMP7, BMP-7, OP-1, Osteogenic Protein 1, Eptotermin alfa, OP1) discontinued

Sign In for Pricing
View Details
N-(2,3-Dichlorophenyl)piperazine
MBS6052669-01 100 mg

N-(2,3-Dichlorophenyl)piperazine

Sign In for Pricing
View Details
N-(2,3-Dichlorophenyl)piperazine
MBS6052669-02 5x 100 mg

N-(2,3-Dichlorophenyl)piperazine

Sign In for Pricing
View Details
STRADB Antibody
orb519910-01 50 μL

STRADB Antibody

Sign In for Pricing
View Details
STRADB Antibody
orb519910-02 100 µL

STRADB Antibody

Sign In for Pricing
View Details
SHF 3'UTR Luciferase Stable Cell Line
TU023137 1.0 mL

SHF 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details