Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse LIF Protein

Recombinant of mouse LIF protein

Product Specifications

Product Name Alternative

CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA.

Source

Escherichia Coli

Field of Research

Immunology & Inflammation

Purity

Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be < 0.01 ng/ml, corresponding to a specific activity of 100,000,000 IU/mg.A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.

AA Sequence

MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IFNGR2 Protein, N-His
orb2833418-01 20 µg

Recombinant Human IFNGR2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IFNGR2 Protein, N-His
orb2833418-02 50 µg

Recombinant Human IFNGR2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IFNGR2 Protein, N-His
orb2833418-03 100 µg

Recombinant Human IFNGR2 Protein, N-His

Sign In for Pricing
View Details
SLC4A7 Antibody
orb522907-01 50 μL

SLC4A7 Antibody

Sign In for Pricing
View Details
SLC4A7 Antibody
orb522907-02 100 µL

SLC4A7 Antibody

Sign In for Pricing
View Details
Lfc Rabbit Polyclonal Antibody
APRab13283-01 20 µL

Lfc Rabbit Polyclonal Antibody

Sign In for Pricing
View Details