Human MIF (Active) Protein
Recombinant of human MIF (Active) protein
Product Specifications
Product Name Alternative
Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
Source
Escherichia Coli
Field of Research
Immunology & Inflammation
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml.
Storage Conditions
Stability: Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
AA Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2618679 100 µg
Ceruloplasmin/CP Rabbit Polyclonal Antibody (APC)
Sign In for Pricing
View Details 
249489-FITC 100 µL
NRBP1 (Nuclear Receptor Binding Protein 1, BCON3, FLJ27109, FLJ35541, MADM, MUDPNP, NRBP) (FITC)
Sign In for Pricing
View Details