Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIF (Active) Protein

Recombinant of human MIF (Active) protein

Product Specifications

Product Name Alternative

Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.

Source

Escherichia Coli

Field of Research

Immunology & Inflammation

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml.

Storage Conditions

Stability: Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.

AA Sequence

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Danio rerio Integrator complex subunit 7 (ints7), partial
MBS1295462 Inquire

Recombinant Danio rerio Integrator complex subunit 7 (ints7), partial

Sign In for Pricing
View Details
2-Formyl-4,5-dimethoxybenzoic acid
OR1033802-01 100 mg

2-Formyl-4,5-dimethoxybenzoic acid

Sign In for Pricing
View Details
2-Formyl-4,5-dimethoxybenzoic acid
OR1033802-02 250 mg

2-Formyl-4,5-dimethoxybenzoic acid

Sign In for Pricing
View Details
2-Formyl-4,5-dimethoxybenzoic acid
OR1033802-03 1 g

2-Formyl-4,5-dimethoxybenzoic acid

Sign In for Pricing
View Details
2-Formyl-4,5-dimethoxybenzoic acid
OR1033802-04 5 g

2-Formyl-4,5-dimethoxybenzoic acid

Sign In for Pricing
View Details
ASB8 Mouse Monoclonal Antibody [Clone ID: LBI1A6]
AMM18340VCF 100 µg

ASB8 Mouse Monoclonal Antibody [Clone ID: LBI1A6]

Sign In for Pricing
View Details