What is the catalog number for Human OSM (209 a.a) Protein?

The catalog number for Human OSM (209 a.a) Protein is orb427492.

What sizes are available for Human OSM (209 a.a) Protein?

Human OSM (209 a.a) Protein is available in the following size(s): 2 µg, 10 µg, 1 mg.

How many pack sizes does Human OSM (209 a.a) Protein come in?

Human OSM (209 a.a) Protein is available in 3 different pack sizes.

Is Human OSM (209 a.a) Protein in stock?

Human OSM (209 a.a) Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human OSM (209 a.a) Protein

Recombinant of human OSM (209 a.a) protein

Product Specifications

Product Name Alternative

OSM, MGC20461, Oncostatin M.

Source

Escherichia Coli

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 97.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependant stimulation of Human TF-1 cells is < 2 ng/ml, corresponding to a Specific Activity of 500,000 IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Oncostatin-M (209 a.a.) in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1mg/ml) solution containing 1x PBS pH-7.4.

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR