Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OSM (209 a.a) Protein

Recombinant of human OSM (209 a.a) protein

Product Specifications

Product Name Alternative

OSM, MGC20461, Oncostatin M.

Source

Escherichia Coli

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 97.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependant stimulation of Human TF-1 cells is < 2 ng/ml, corresponding to a Specific Activity of 500,000 IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Oncostatin-M (209 a.a.) in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1mg/ml) solution containing 1x PBS pH-7.4.

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zap70 Antibody
orb515608-01 50 µg

Zap70 Antibody

Sign In for Pricing
View Details
Zap70 Antibody
orb515608-02 100 µg

Zap70 Antibody

Sign In for Pricing
View Details
SIRP alpha (SIRPA) Mouse Monoclonal Antibody [Clone:1C6]
E45M14247 100 µg

SIRP alpha (SIRPA) Mouse Monoclonal Antibody [Clone:1C6]

Sign In for Pricing
View Details
CD34 Antibody
orb1315135-01 30 µL

CD34 Antibody

Sign In for Pricing
View Details
CD34 Antibody
orb1315135-02 50 μL

CD34 Antibody

Sign In for Pricing
View Details
CD34 Antibody
orb1315135-03 100 µL

CD34 Antibody

Sign In for Pricing
View Details