Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TFF1 Protein

Recombinant of human TFF1 protein

Product Specifications

Product Name Alternative

TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.

Source

Escherichia Coli

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10μg/ml, corresponding to a specific activity of >100 IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized TFF1 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

The Human TFF1 protein was lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl.

AA Sequence

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ccl22 shRNA (UAS) - Lentiviral mouse Ccl22 shRNA (UAS) (100)
GTR15288918 1 Vial

Lentiviral mouse Ccl22 shRNA (UAS) - Lentiviral mouse Ccl22 shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Human LY6E/SCA-2 Protein, C-Fc
AP96294 50 µg

Recombinant Human LY6E/SCA-2 Protein, C-Fc

Sign In for Pricing
View Details
Porcine Mitochondrial import inner membrane translocase subunit Tim13 (TIMM13) ELISA Kit
MBS7220869-01 48 Well

Porcine Mitochondrial import inner membrane translocase subunit Tim13 (TIMM13) ELISA Kit

Sign In for Pricing
View Details
Porcine Mitochondrial import inner membrane translocase subunit Tim13 (TIMM13) ELISA Kit
MBS7220869-02 96 Well

Porcine Mitochondrial import inner membrane translocase subunit Tim13 (TIMM13) ELISA Kit

Sign In for Pricing
View Details
Porcine Mitochondrial import inner membrane translocase subunit Tim13 (TIMM13) ELISA Kit
MBS7220869-03 5x 96 Well

Porcine Mitochondrial import inner membrane translocase subunit Tim13 (TIMM13) ELISA Kit

Sign In for Pricing
View Details
Porcine Mitochondrial import inner membrane translocase subunit Tim13 (TIMM13) ELISA Kit
MBS7220869-04 10x 96 Well

Porcine Mitochondrial import inner membrane translocase subunit Tim13 (TIMM13) ELISA Kit

Sign In for Pricing
View Details