What is the catalog number for Human TNFR (His) Protein?

The catalog number for Human TNFR (His) Protein is orb428897.

What sizes are available for Human TNFR (His) Protein?

Human TNFR (His) Protein is available in the following size(s): 5 µg, 20 µg, 1 mg.

How many pack sizes does Human TNFR (His) Protein come in?

Human TNFR (His) Protein is available in 3 different pack sizes.

Is Human TNFR (His) Protein in stock?

Human TNFR (His) Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human TNFR (His) Protein

Recombinant of human TNFR (His) protein

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered clear solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

TNFR His Tag protein is supplied in 1xPBS, 50% glycerol.

AA Sequence

DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN